Lineage for d3sw3a_ (3sw3 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2996664Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2996665Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) (S)
  5. 2996666Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 2996667Protein Zn metallo-beta-lactamase [56283] (14 species)
  7. 2996668Species Aeromonas hydrophila, CphA [TaxId:644] [118144] (11 PDB entries)
    Uniprot P26918 28-252
  8. 2996679Domain d3sw3a_: 3sw3 A: [216581]
    automated match to d3t9ma_
    mutant

Details for d3sw3a_

PDB Entry: 3sw3 (more details), 2.35 Å

PDB Description: EDTA-free crystal structure of the mutant C221D of carbapenemase CphA from Aeromonas hydrophila
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d3sw3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sw3a_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Aeromonas hydrophila, CphA [TaxId: 644]}
agmsltqvsgpvyvvednyyvqensmvyfgakgvtvvgatwtpdtarelhklikrvsrkp
vlevintnyhtdraggnaywksigakvvstrqtrdlmksdwaeivaftrkglpeypdlpl
vlpnvvhdgdftlqegkvrafyagpahtpdgifvyfpdeqvlygndilkeklgnlsfadv
kaypqtlerlkamklpiktvigghd

SCOPe Domain Coordinates for d3sw3a_:

Click to download the PDB-style file with coordinates for d3sw3a_.
(The format of our PDB-style files is described here.)

Timeline for d3sw3a_: