SCOPe 2.01: Domain d1d3la1: 1d3l A:83-185

Lineage for d1d3la1 (1d3l A:83-185)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.3: C2 set domains [49142] (8 proteins)

6. Protein Intercellular cell adhesion molecule-1 (ICAM-1) [49145] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49146] (7 PDB entries)

8. Domain d1d3la1: 1d3l A:83-185 [21656]
   Other proteins in same PDB: d1d3la2
   D2

Details for d1d3la1

PDB Entry: 1d3l, 3.25 Å

PDB Description: d1d2-icam-1 fully glycosylated, variation of d1-d2 interdomain angle in different crystal structures.

PDB Compounds: (A:) protein (intercellular adhesion molecule-1)

SCOPe Domain Sequences for d1d3la1:

Sequence; same for both SEQRES and ATOM records:

>d1d3la1 b.1.1.3 (A:83-185) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]}
ywtpervelaplpswqpvgknltlrcqveggapranltvvllrgekelkrepavgepaev
tttvlvrrdhhganfscrteldlrpqglelfentsapyqlqtf

Timeline for d1d3la1:

• d1d3la1 first appeared (with stable ids) in SCOP 1.55
  
• d1d3la1 appears in SCOP 1.75
  
• d1d3la1 appears in SCOPe 2.02
  
• d1d3la1 appears in the current release, SCOPe 2.08