SCOPe 2.08: Domain d3si9c1: 3si9 C:5-296

Lineage for d3si9c1 (3si9 C:5-296)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.0: automated matches [191319] (1 protein)
   not a true family

6. Protein automated matches [190115] (94 species)
   not a true protein

7. Species Bartonella henselae [TaxId:38323] [189345] (2 PDB entries)

8. Domain d3si9c1: 3si9 C:5-296 [216420]
   Other proteins in same PDB: d3si9a2, d3si9b2, d3si9c2, d3si9d2
   automated match to d3flua_
   complexed with edo

Details for d3si9c1

PDB Entry: 3si9, 2.1 Å

PDB Description: crystal structure of dihydrodipicolinate synthase from bartonella henselae

PDB Compounds: (C:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d3si9c1:

Sequence; same for both SEQRES and ATOM records:

>d3si9c1 c.1.10.0 (C:5-296) automated matches {Bartonella henselae [TaxId: 38323]}
mlkgavtalitpfddngaidekafcnfvewqitqgingvspvgttgesptltheehkrii
elcveqvakrvpvvagagsnstseavelakhaekagadavlvvtpyynrpnqrglythfs
siakaisipiiiynipsrsvidmavetmrdlcrdfkniigvkdatgkieraseqrekcgk
dfvqlsgddctalgfnahggvgcisvssnvapklcaqlhaaclcsdyktalklndllmpl
nravfiepspagikyaaaklglcgtivrspivplsdttkkiidealyhagll

Timeline for d3si9c1:

• d3si9c1 first appeared in SCOPe 2.03, called d3si9c_
  
• d3si9c1 appears in SCOPe 2.07