Lineage for d3sdya1 (3sdy A:11-327)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2047495Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2047496Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2047543Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2047544Protein Hemagglutinin [49824] (9 species)
    includes rudiment esterase domain
  7. 2047584Species Influenza A virus, different strains [TaxId:11320] [49825] (116 PDB entries)
  8. 2047725Domain d3sdya1: 3sdy A:11-327 [216356]
    Other proteins in same PDB: d3sdya2, d3sdyb_, d3sdyl1, d3sdyl2
    automated match to d2viua_
    complexed with so4

Details for d3sdya1

PDB Entry: 3sdy (more details), 2.85 Å

PDB Description: crystal structure of broadly neutralizing antibody cr8020 bound to the influenza a h3 hemagglutinin
PDB Compounds: (A:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d3sdya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sdya1 b.19.1.2 (A:11-327) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
atlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctlidal
lgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftwtgv
tqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhpstnqe
qtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvinsngn
liaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpkyvk
qntlklatgmrnvpekq

SCOPe Domain Coordinates for d3sdya1:

Click to download the PDB-style file with coordinates for d3sdya1.
(The format of our PDB-style files is described here.)

Timeline for d3sdya1: