Lineage for d3roda_ (3rod A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1864482Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 1864483Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1865706Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 1865707Protein automated matches [190689] (49 species)
    not a true protein
  7. 1865811Species Human (Homo sapiens) [TaxId:9606] [187871] (11 PDB entries)
  8. 1865831Domain d3roda_: 3rod A: [215951]
    automated match to d2i62b_
    complexed with nca, sah

Details for d3roda_

PDB Entry: 3rod (more details), 2.72 Å

PDB Description: Methyltransferase
PDB Compounds: (A:) Nicotinamide N-methyltransferase

SCOPe Domain Sequences for d3roda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3roda_ c.66.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sgftskdtylshfnprdylekyykfgsrhsaesqilkhllknlfkifcldgvkgdllidi
gsgptiyqllsacesfkeivvtdysdqnlqelekwlkaapaafdwspvvtyvcdlegnrv
kgpekeeklrqavkqvlkcdvtqsqplgavplppadcvlstlcldaacpdlptycralrn
lgsllkpggflvimdalkssyymigeqkfsslplgreaveaavkeagytiewfevisqsy
sstmanneglfslvarkls

SCOPe Domain Coordinates for d3roda_:

Click to download the PDB-style file with coordinates for d3roda_.
(The format of our PDB-style files is described here.)

Timeline for d3roda_: