Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) |
Family c.66.1.0: automated matches [191451] (1 protein) not a true family |
Protein automated matches [190689] (49 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187871] (11 PDB entries) |
Domain d3roda_: 3rod A: [215951] automated match to d2i62b_ complexed with nca, sah |
PDB Entry: 3rod (more details), 2.72 Å
SCOPe Domain Sequences for d3roda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3roda_ c.66.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} sgftskdtylshfnprdylekyykfgsrhsaesqilkhllknlfkifcldgvkgdllidi gsgptiyqllsacesfkeivvtdysdqnlqelekwlkaapaafdwspvvtyvcdlegnrv kgpekeeklrqavkqvlkcdvtqsqplgavplppadcvlstlcldaacpdlptycralrn lgsllkpggflvimdalkssyymigeqkfsslplgreaveaavkeagytiewfevisqsy sstmanneglfslvarkls
Timeline for d3roda_: