Lineage for d3ro6e1 (3ro6 E:1-125)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2191243Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2191244Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2191540Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2191541Protein automated matches [226922] (88 species)
    not a true protein
  7. 2191961Species Methylococcus capsulatus [TaxId:414] [226116] (2 PDB entries)
  8. 2191966Domain d3ro6e1: 3ro6 E:1-125 [215936]
    Other proteins in same PDB: d3ro6a2, d3ro6b2, d3ro6c2, d3ro6d2, d3ro6e2, d3ro6f2
    automated match to d1jpma2
    complexed with gol, mg, so4

Details for d3ro6e1

PDB Entry: 3ro6 (more details), 2.2 Å

PDB Description: crystal structure of dipeptide epimerase from methylococcus capsulatus complexed with mg ion
PDB Compounds: (E:) Putative chloromuconate cycloisomerase

SCOPe Domain Sequences for d3ro6e1:

Sequence, based on SEQRES records: (download)

>d3ro6e1 d.54.1.0 (E:1-125) automated matches {Methylococcus capsulatus [TaxId: 414]}
mkiadiqvrtehfpltrpyriafrsieeidnliveirtadgllglgaasperhvtgetle
achaaldhdrlgwlmgrdirtlprlcrelaerlpaapaaraaldmalhdlvaqclglplv
eilgr

Sequence, based on observed residues (ATOM records): (download)

>d3ro6e1 d.54.1.0 (E:1-125) automated matches {Methylococcus capsulatus [TaxId: 414]}
mkiadiqvrtehfplteeidnliveirtadgllglgaasperhvtgetleachaaldhdr
lgwlmgrdirtlprlcrelaerlpaapaaraaldmalhdlvaqclglplveilgr

SCOPe Domain Coordinates for d3ro6e1:

Click to download the PDB-style file with coordinates for d3ro6e1.
(The format of our PDB-style files is described here.)

Timeline for d3ro6e1: