Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
Protein automated matches [226923] (71 species) not a true protein |
Species Methylococcus capsulatus [TaxId:414] [226117] (2 PDB entries) |
Domain d3ro6a2: 3ro6 A:126-355 [215929] Other proteins in same PDB: d3ro6a1, d3ro6b1, d3ro6c1, d3ro6d1, d3ro6e1, d3ro6f1 automated match to d1jpma1 complexed with gol, mg, so4 |
PDB Entry: 3ro6 (more details), 2.2 Å
SCOPe Domain Sequences for d3ro6a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ro6a2 c.1.11.0 (A:126-355) automated matches {Methylococcus capsulatus [TaxId: 414]} ahdslptsvtigikpveetlaearehlalgfrvlkvklcgdeeqdferlrrlhetlagra vvrvdpnqsydrdgllrldrlvqelgiefieqpfpagrtdwlralpkairrriaadesll gpadafalaappaacgifniklmkcgglaparriatiaetagidlmwgcmdesrisiaaa lhaalacpatryldldgsfdlardvaeggfiledgrlrvterpglglvyp
Timeline for d3ro6a2: