Lineage for d3rjja1 (3rjj A:10-91)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2715906Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 2715907Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins)
  6. 2715908Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species)
    topologically similar to the second domain
  7. 2715909Species Human (Homo sapiens) [TaxId:9606] [47805] (145 PDB entries)
    Uniprot P06746
  8. 2715918Domain d3rjja1: 3rjj A:10-91 [215883]
    Other proteins in same PDB: d3rjja2, d3rjja3
    automated match to d1tv9a1
    protein/DNA complex; complexed with na

Details for d3rjja1

PDB Entry: 3rjj (more details), 2 Å

PDB Description: Ternary complex crystal structure of DNA Polymerase Beta with template 8odG provides insight into mutagenic lesion bypass
PDB Compounds: (A:) DNA polymerase beta

SCOPe Domain Sequences for d3rjja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rjja1 a.60.6.1 (A:10-91) DNA polymerase beta, N-terminal (8 kD)-domain {Human (Homo sapiens) [TaxId: 9606]}
tlnggitdmltelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtki
aekideflatgklrklekirqd

SCOPe Domain Coordinates for d3rjja1:

Click to download the PDB-style file with coordinates for d3rjja1.
(The format of our PDB-style files is described here.)

Timeline for d3rjja1: