Lineage for d3rita2 (3rit A:126-354)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2836768Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2837252Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 2837253Protein automated matches [226923] (79 species)
    not a true protein
  7. 2837596Species Methylococcus capsulatus [TaxId:414] [226117] (2 PDB entries)
  8. 2837597Domain d3rita2: 3rit A:126-354 [215856]
    Other proteins in same PDB: d3rita1, d3ritb1, d3ritc1, d3ritd1, d3rite1
    automated match to d1jpma1
    complexed with 1pe, arg, dly, mg, so4

Details for d3rita2

PDB Entry: 3rit (more details), 2.7 Å

PDB Description: Crystal structure of Dipeptide Epimerase from Methylococcus capsulatus complexed with Mg and dipeptide L-Arg-D-Lys
PDB Compounds: (A:) Dipeptide Epimerase

SCOPe Domain Sequences for d3rita2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rita2 c.1.11.0 (A:126-354) automated matches {Methylococcus capsulatus [TaxId: 414]}
ahdslptsvtigikpveetlaearehlalgfrvlkvklcgdeeqdferlrrlhetlagra
vvrvdpnqsydrdgllrldrlvqelgiefieqpfpagrtdwlralpkairrriaadesll
gpadafalaappaacgifniklmkcgglaparriatiaetagidlmwgcmdesrisiaaa
lhaalacpatryldldgsfdlardvaeggfiledgrlrvterpglglvy

SCOPe Domain Coordinates for d3rita2:

Click to download the PDB-style file with coordinates for d3rita2.
(The format of our PDB-style files is described here.)

Timeline for d3rita2: