Class b: All beta proteins [48724] (111 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (12 species) |
Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [49134] (9 PDB entries) |
Domain d1aqda1: 1aqd A:82-181 [21585] Other proteins in same PDB: d1aqda2, d1aqdb2, d1aqdd2, d1aqde2, d1aqdg2, d1aqdh2, d1aqdj2, d1aqdk2 |
PDB Entry: 1aqd (more details), 2.45 Å
SCOP Domain Sequences for d1aqda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aqda1 b.1.1.2 (A:82-181) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR1} itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre dhlfrkfhylpflpstedvydcrvehwgldepllkhwefd
Timeline for d1aqda1: