Lineage for d1aqdh2 (1aqd H:4-92)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 190293Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
  4. 190294Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 190295Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins)
  6. 190467Protein MHC class II, N-terminal domains of alpha and beta chains [54458] (12 species)
  7. 190474Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [54460] (9 PDB entries)
  8. 190484Domain d1aqdh2: 1aqd H:4-92 [38164]
    Other proteins in same PDB: d1aqda1, d1aqdb1, d1aqdd1, d1aqde1, d1aqdg1, d1aqdh1, d1aqdj1, d1aqdk1

Details for d1aqdh2

PDB Entry: 1aqd (more details), 2.45 Å

PDB Description: hla-dr1 (dra, drb1 0101) human class ii histocompatibility protein (extracellular domain) complexed with endogenous peptide
PDB Compounds: (H:)

SCOP Domain Sequences for d1aqdh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aqdh2 d.19.1.1 (H:4-92) MHC class II, N-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR1}
rprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaeywns
qkdlleqrraavdtycrhnygvgesftvq

SCOP Domain Coordinates for d1aqdh2:

Click to download the PDB-style file with coordinates for d1aqdh2.
(The format of our PDB-style files is described here.)

Timeline for d1aqdh2: