Lineage for d1i1ad1 (1i1a D:239-341)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1105902Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1108193Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species)
  7. 1108248Species Norway rat (Rattus norvegicus) [TaxId:10116] [88588] (2 PDB entries)
  8. 1108252Domain d1i1ad1: 1i1a D:239-341 [21542]
    Other proteins in same PDB: d1i1aa1, d1i1aa2, d1i1ab_, d1i1ac2, d1i1ad2
    part of a Fc
    complexed with cys, nag, ndg

Details for d1i1ad1

PDB Entry: 1i1a (more details), 2.8 Å

PDB Description: crystal structure of the neonatal fc receptor complexed with a heterodimeric fc
PDB Compounds: (D:) ig gamma-2a chain c region

SCOPe Domain Sequences for d1i1ad1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i1ad1 b.1.1.2 (D:239-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Norway rat (Rattus norvegicus) [TaxId: 10116]}
svfifppktkdvlgggltpkvtcvvvdisqndpevrfswfiddvevhtaqthapekqsns
tlrsvselpiverdwlngktfkckvnsgafpapieksiskpeg

SCOPe Domain Coordinates for d1i1ad1:

Click to download the PDB-style file with coordinates for d1i1ad1.
(The format of our PDB-style files is described here.)

Timeline for d1i1ad1: