Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Immunoglobulin heavy chain epsilon constant domain 4, CH4-epsilon [88598] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [88599] (3 PDB entries) |
Domain d1f6ad2: 1f6a D:439-544 [21535] Other proteins in same PDB: d1f6aa1, d1f6aa2, d1f6ab1, d1f6ad1 polysaccharide binding antibody complexed with cps, so4 |
PDB Entry: 1f6a (more details), 3.5 Å
SCOPe Domain Sequences for d1f6ad2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f6ad2 b.1.1.2 (D:439-544) Immunoglobulin heavy chain epsilon constant domain 4, CH4-epsilon {Human (Homo sapiens) [TaxId: 9606]} praapevyafatpewpgsrdkrtlacliqnfmpedisvqwlhnevqlpdarhsttqprkt kgsgffvfsrlevtraeweqkdeficravheaaspsqtvqravsvn
Timeline for d1f6ad2:
View in 3D Domains from other chains: (mouse over for more information) d1f6aa1, d1f6aa2, d1f6ab1, d1f6ab2 |