Lineage for d1f6ad1 (1f6a D:329-438)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1292184Protein Immunoglobulin heavy chain epsilon constant domain 3, CH3-epsilon [88596] (1 species)
  7. 1292185Species Human (Homo sapiens) [TaxId:9606] [88597] (3 PDB entries)
  8. 1292190Domain d1f6ad1: 1f6a D:329-438 [21534]
    Other proteins in same PDB: d1f6aa1, d1f6aa2, d1f6ab2, d1f6ad2
    complexed with cps, so4

Details for d1f6ad1

PDB Entry: 1f6a (more details), 3.5 Å

PDB Description: structure of the human ige-fc bound to its high affinity receptor fc(epsilon)ri(alpha)
PDB Compounds: (D:) ig epsilon chain c region

SCOPe Domain Sequences for d1f6ad1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f6ad1 b.1.1.2 (D:329-438) Immunoglobulin heavy chain epsilon constant domain 3, CH3-epsilon {Human (Homo sapiens) [TaxId: 9606]}
cdsnprgvsaylsrpspfdlfirksptitclvvdlapskgtvnltwsrasgkpvnhstrk
eekqrngtltvtstlpvgtrdwiegetyqcrvthphlpralmrsttktsg

SCOPe Domain Coordinates for d1f6ad1:

Click to download the PDB-style file with coordinates for d1f6ad1.
(The format of our PDB-style files is described here.)

Timeline for d1f6ad1: