SCOPe 2.05: Domain d3qlfa_: 3qlf A:

Lineage for d3qlfa_ (3qlf A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein c-src tyrosine kinase [56155] (2 species)
   PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase

7. Species Chicken (Gallus gallus) [TaxId:9031] [56157] (39 PDB entries)

8. Domain d3qlfa_: 3qlf A: [215282]
   automated match to d2gqgb_
   complexed with pd5; mutant

Details for d3qlfa_

PDB Entry: 3qlf, 2.75 Å

PDB Description: Crystal structure of the L317I mutant of the C-src tyrosine kinase domain complexed with pyrazolopyrimidine 5

PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase Src

SCOPe Domain Sequences for d3qlfa_:

Sequence, based on SEQRES records:

>d3qlfa_ d.144.1.7 (A:) c-src tyrosine kinase {Chicken (Gallus gallus) [TaxId: 9031]}
daweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkki
rheklvqlyavvseepiyivteymskgslldflkgemgkylrlpqlvdmaaqiasgmayv
ermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpikwtapeaalyg
rftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcq
cwrkdpeerptfeylqafledyftstepqyqpgenl

Sequence, based on observed residues (ATOM records):

>d3qlfa_ d.144.1.7 (A:) c-src tyrosine kinase {Chicken (Gallus gallus) [TaxId: 9031]}
daweipreslrlevklgqgcfgevwmgtwngttrvaiktlklqeaqvmkkirheklvqly
avvseepiyivteymskgslldflkgemgkylrlpqlvdmaaqiasgmayvermnyvhrd
lraanilvgenlvckvadffpikwtapeaalygrftiksdvwsfgilltelttkgrvpyp
gmvnrevldqvergyrmpcppecpeslhdlmcqcwrkdpeerptfeylqafledyftste
pqyqpgenl

Timeline for d3qlfa_:

• d3qlfa_ first appeared in SCOPe 2.03
  
• d3qlfa_ appears in SCOPe 2.04
  
• d3qlfa_ appears in SCOPe 2.06
  
• d3qlfa_ appears in the current release, SCOPe 2.08