SCOP 1.57: Domain d1e4ka1: 1e4k A:229-341

Lineage for d1e4ka1 (1e4k A:229-341)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)

7. Species Fc (human) IgG1 class [49120] (8 PDB entries)

8. Domain d1e4ka1: 1e4k A:229-341 [21526]
   Other proteins in same PDB: d1e4kc1, d1e4kc2

Details for d1e4ka1

PDB Entry: 1e4k, 3.2 Å

PDB Description: crystal structure of soluble human igg1 fc fragment-fc-gamma receptor iii complex

SCOP Domain Sequences for d1e4ka1:

Sequence; same for both SEQRES and ATOM records:

>d1e4ka1 b.1.1.2 (A:229-341) Immunoglobulin (constant domains of L and H chains) {Fc (human) IgG1 class}
cpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqvhnak
tkpreqqynstyrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakg

Timeline for d1e4ka1:

• d1e4ka1 first appeared (with stable ids) in SCOP 1.55
  
• d1e4ka1 appears in SCOP 1.59
  
• d1e4ka1 appears in the current release, SCOPe 2.08