Lineage for d1e4ka2 (1e4k A:342-444)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 52912Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 53260Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)
  7. 53986Species Fc (human) IgG1 class [49120] (8 PDB entries)
  8. 54008Domain d1e4ka2: 1e4k A:342-444 [21527]
    Other proteins in same PDB: d1e4kc1, d1e4kc2

Details for d1e4ka2

PDB Entry: 1e4k (more details), 3.2 Å

PDB Description: crystal structure of soluble human igg1 fc fragment-fc-gamma receptor iii complex

SCOP Domain Sequences for d1e4ka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e4ka2 b.1.1.2 (A:342-444) Immunoglobulin (constant domains of L and H chains) {Fc (human) IgG1 class}
qprepqvytlppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvldsd
gsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsls

SCOP Domain Coordinates for d1e4ka2:

Click to download the PDB-style file with coordinates for d1e4ka2.
(The format of our PDB-style files is described here.)

Timeline for d1e4ka2: