Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) |
Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins) |
Protein automated matches [190032] (11 species) not a true protein |
Species Staphylococcus aureus [TaxId:93062] [196295] (6 PDB entries) |
Domain d3q8yg_: 3q8y G: [215129] automated match to d3q83f_ complexed with adp, mg, vo4 |
PDB Entry: 3q8y (more details), 2.7 Å
SCOPe Domain Sequences for d3q8yg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3q8yg_ d.58.6.1 (G:) automated matches {Staphylococcus aureus [TaxId: 93062]} mertflmikpdavqrnligevisrierkglklvggklmqvpmelaethygehqgkpfynd lisfitsapvfamvvegedavnvsrhiigstnpseaspgsirgdlgltvgrniihgsdsl esaereinlwfneneitsyasprdawlye
Timeline for d3q8yg_: