Lineage for d3q8ub_ (3q8u B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1413688Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1415050Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 1415051Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 1415295Protein automated matches [190032] (11 species)
    not a true protein
  7. 1415460Species Staphylococcus aureus [TaxId:93062] [196295] (6 PDB entries)
  8. 1415464Domain d3q8ub_: 3q8u B: [215110]
    automated match to d3q83f_
    complexed with adp, mg

Details for d3q8ub_

PDB Entry: 3q8u (more details), 2.22 Å

PDB Description: Crystal structure of Staphylococcus aureus nucleoside diphosphate kinase complexed with ADP
PDB Compounds: (B:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d3q8ub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q8ub_ d.58.6.1 (B:) automated matches {Staphylococcus aureus [TaxId: 93062]}
mertflmikpdavqrnligevisrierkglklvggklmqvpmelaethygehqgkpfynd
lisfitsapvfamvvegedavnvsrhiigstnpseaspgsirgdlgltvgrniihgsdsl
esaereinlwfneneitsyasprdawlye

SCOPe Domain Coordinates for d3q8ub_:

Click to download the PDB-style file with coordinates for d3q8ub_.
(The format of our PDB-style files is described here.)

Timeline for d3q8ub_: