Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) |
Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins) |
Protein automated matches [190079] (7 species) not a true protein |
Species Serratia fonticola [TaxId:47917] [196325] (2 PDB entries) |
Domain d3q6vb_: 3q6v B: [215090] automated match to d3sd9b_ complexed with gol, zn |
PDB Entry: 3q6v (more details), 1.37 Å
SCOPe Domain Sequences for d3q6vb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3q6vb_ d.157.1.1 (B:) automated matches {Serratia fonticola [TaxId: 47917]} nltlthfkgplyivedkeyvqensmvyigtdgitiigatwtpetaetlykeirkvsplpi nevintnyhtdraggnaywktlgakivatqmtydlqksqwgsivnftrqgnnkypnleks lpdtvfpgdfnlqngsiramylgeahtkdgifvyfpaervlygncilkenlgnmsfanrt eypktleklkglieqgelkvdsiiaghdtpihdvglidhyltllekap
Timeline for d3q6vb_: