SCOPe 2.04: Domain d3q6va_: 3q6v A:

Lineage for d3q6va_ (3q6v A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)

6. Protein automated matches [190079] (7 species)
   not a true protein

7. Species Serratia fonticola [TaxId:47917] [196325] (2 PDB entries)

8. Domain d3q6va_: 3q6v A: [215089]
   automated match to d3sd9b_
   complexed with gol, zn

Details for d3q6va_

PDB Entry: 3q6v, 1.37 Å

PDB Description: crystal structure of serratia fonticola sfh-i: glycerol complex

PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d3q6va_:

Sequence; same for both SEQRES and ATOM records:

>d3q6va_ d.157.1.1 (A:) automated matches {Serratia fonticola [TaxId: 47917]}
nltlthfkgplyivedkeyvqensmvyigtdgitiigatwtpetaetlykeirkvsplpi
nevintnyhtdraggnaywktlgakivatqmtydlqksqwgsivnftrqgnnkypnleks
lpdtvfpgdfnlqngsiramylgeahtkdgifvyfpaervlygncilkenlgnmsfanrt
eypktleklkglieqgelkvdsiiaghdtpihdvglidhyltllekap

Timeline for d3q6va_:

• d3q6va_ first appeared in SCOPe 2.03
  
• d3q6va_ appears in SCOPe 2.05
  
• d3q6va_ appears in the current release, SCOPe 2.08