SCOPe 2.05: Domain d3q6gm1: 3q6g M:2-107

Lineage for d3q6gm1 (3q6g M:2-107)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [226133] (5 PDB entries)

8. Domain d3q6gm1: 3q6g M:2-107 [215080]
   Other proteins in same PDB: d3q6gl2, d3q6gm2
   automated match to d1w72l1

Details for d3q6gm1

PDB Entry: 3q6g, 1.9 Å

PDB Description: Crystal structure of Fab of rhesus mAb 2.5B specific for quaternary neutralizing epitope of HIV-1 gp120

PDB Compounds: (M:) Light chain of Fab of rhesus mAb 2.5B

SCOPe Domain Sequences for d3q6gm1:

Sequence; same for both SEQRES and ATOM records:

>d3q6gm1 b.1.1.0 (M:2-107) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
ydltqarsvsvspgqtarvtcggdnigsksvqwyqqkppqapvlvmsadderssgiperf
sgsnsgntatltisgveagdeadyycqvwdssshhmlfgggtrltvlg

Timeline for d3q6gm1:

• d3q6gm1 first appeared in SCOPe 2.03
  
• d3q6gm1 appears in SCOPe 2.04
  
• d3q6gm1 appears in SCOPe 2.06
  
• d3q6gm1 appears in the current release, SCOPe 2.08