Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (26 species) not a true protein |
Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [226133] (5 PDB entries) |
Domain d3q6gm1: 3q6g M:2-107 [215080] Other proteins in same PDB: d3q6gl2, d3q6gm2 automated match to d1w72l1 |
PDB Entry: 3q6g (more details), 1.9 Å
SCOPe Domain Sequences for d3q6gm1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3q6gm1 b.1.1.0 (M:2-107) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]} ydltqarsvsvspgqtarvtcggdnigsksvqwyqqkppqapvlvmsadderssgiperf sgsnsgntatltisgveagdeadyycqvwdssshhmlfgggtrltvlg
Timeline for d3q6gm1: