SCOPe 2.08: Domain d3pztb_: 3pzt B:

Lineage for d3pztb_ (3pzt B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.0: automated matches [191314] (1 protein)
   not a true family

6. Protein automated matches [190075] (132 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:224308] [226199] (3 PDB entries)

8. Domain d3pztb_: 3pzt B: [214997]
   automated match to d2cksa_
   complexed with gol, mn, po4

Details for d3pztb_

PDB Entry: 3pzt, 1.97 Å

PDB Description: Structure of the endo-1,4-beta-glucanase from Bacillus subtilis 168 with manganese(II) ion

PDB Compounds: (B:) endoglucanase

SCOPe Domain Sequences for d3pztb_:

Sequence; same for both SEQRES and ATOM records:

>d3pztb_ c.1.8.0 (B:) automated matches {Bacillus subtilis [TaxId: 224308]}
vakngqlsikgtqlvnrdgkavqlkgisshglqwygeyvnkdslkwlrddwgitvfraam
ytadggyidnpsvknkvkeaveaakelgiyviidwhilndgnpnqnkekakeffkemssl
ygntpnviyeianepngdvnwkrdikpyaeevisvirkndpdniiivgtgtwsqdvndaa
ddqlkdanvmyalhfyagthgqflrdkanyalskgapifvtewgtsdasgnggvfldqsr
ewlkyldsktiswvnwnlsdkqesssalkpgasktggwrlsdlsasgtfvrenilg

Timeline for d3pztb_:

• d3pztb_ first appeared in SCOPe 2.03
  
• d3pztb_ appears in SCOPe 2.07