Lineage for d3pzta_ (3pzt A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1818156Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1820295Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 1820296Protein automated matches [190075] (72 species)
    not a true protein
  7. 1820339Species Bacillus subtilis [TaxId:224308] [226199] (3 PDB entries)
  8. 1820340Domain d3pzta_: 3pzt A: [214996]
    automated match to d2cksa_
    complexed with gol, mn, po4

Details for d3pzta_

PDB Entry: 3pzt (more details), 1.97 Å

PDB Description: Structure of the endo-1,4-beta-glucanase from Bacillus subtilis 168 with manganese(II) ion
PDB Compounds: (A:) endoglucanase

SCOPe Domain Sequences for d3pzta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pzta_ c.1.8.0 (A:) automated matches {Bacillus subtilis [TaxId: 224308]}
ngqlsikgtqlvnrdgkavqlkgisshglqwygeyvnkdslkwlrddwgitvfraamyta
dggyidnpsvknkvkeaveaakelgiyviidwhilndgnpnqnkekakeffkemsslygn
tpnviyeianepngdvnwkrdikpyaeevisvirkndpdniiivgtgtwsqdvndaaddq
lkdanvmyalhfyagthgqflrdkanyalskgapifvtewgtsdasgnggvfldqsrewl
kyldsktiswvnwnlsdkqesssalkpgasktggwrlsdlsasgtfvrenilg

SCOPe Domain Coordinates for d3pzta_:

Click to download the PDB-style file with coordinates for d3pzta_.
(The format of our PDB-style files is described here.)

Timeline for d3pzta_: