Lineage for d3ozfd_ (3ozf D:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1610777Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 1610778Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 1611163Family c.61.1.0: automated matches [191528] (1 protein)
    not a true family
  6. 1611164Protein automated matches [190891] (23 species)
    not a true protein
  7. 1611276Species Plasmodium falciparum [TaxId:5838] [226804] (2 PDB entries)
  8. 1611280Domain d3ozfd_: 3ozf D: [214604]
    automated match to d1qk3c_
    complexed with hpa, mg, po4, pop

Details for d3ozfd_

PDB Entry: 3ozf (more details), 1.94 Å

PDB Description: crystal structure of plasmodium falciparum hypoxanthine-guanine- xanthine phosphoribosyltransferase in complex with hypoxanthine
PDB Compounds: (D:) hypoxanthine-guanine-xanthine phosphoribosyltransferase

SCOPe Domain Sequences for d3ozfd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ozfd_ c.61.1.0 (D:) automated matches {Plasmodium falciparum [TaxId: 5838]}
pipnnpgagenafdpvfvndddgydldsfmipahykkyltkvlvpngviknrieklaydi
kkvynneefhilcllkgsrgfftallkhlsrihnysavetskplfgehyvrvksycndqs
tgtleivsedlsclkgkhvlivediidtgktlvkfceylkkfeiktvaiaclfikrtplw
ngfkadfvgfsipdhfvvgysldyneifrdldhcclvndegkkkykat

SCOPe Domain Coordinates for d3ozfd_:

Click to download the PDB-style file with coordinates for d3ozfd_.
(The format of our PDB-style files is described here.)

Timeline for d3ozfd_: