Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.61.1: PRTase-like [53271] (3 families) |
Family c.61.1.0: automated matches [191528] (1 protein) not a true family |
Protein automated matches [190891] (18 species) not a true protein |
Species Plasmodium falciparum [TaxId:5838] [226804] (2 PDB entries) |
Domain d3ozfd_: 3ozf D: [214604] automated match to d1qk3c_ complexed with hpa, mg, po4, pop |
PDB Entry: 3ozf (more details), 1.94 Å
SCOPe Domain Sequences for d3ozfd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ozfd_ c.61.1.0 (D:) automated matches {Plasmodium falciparum [TaxId: 5838]} pipnnpgagenafdpvfvndddgydldsfmipahykkyltkvlvpngviknrieklaydi kkvynneefhilcllkgsrgfftallkhlsrihnysavetskplfgehyvrvksycndqs tgtleivsedlsclkgkhvlivediidtgktlvkfceylkkfeiktvaiaclfikrtplw ngfkadfvgfsipdhfvvgysldyneifrdldhcclvndegkkkykat
Timeline for d3ozfd_: