Lineage for d1e6oh2 (1e6o H:121-219)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 52912Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 53260Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)
  7. 53458Species Fab 13B5 against HIV-1 capsid protein p24, (mouse), kappa L chain [49111] (2 PDB entries)
  8. 53459Domain d1e6oh2: 1e6o H:121-219 [21453]
    Other proteins in same PDB: d1e6oh1, d1e6ol1

Details for d1e6oh2

PDB Entry: 1e6o (more details), 1.8 Å

PDB Description: crystal structure of fab13b5 against hiv-1 capsid protein p24

SCOP Domain Sequences for d1e6oh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e6oh2 b.1.1.2 (H:121-219) Immunoglobulin (constant domains of L and H chains) {Fab 13B5 against HIV-1 capsid protein p24, (mouse), kappa L chain}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivp

SCOP Domain Coordinates for d1e6oh2:

Click to download the PDB-style file with coordinates for d1e6oh2.
(The format of our PDB-style files is described here.)

Timeline for d1e6oh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e6oh1