SCOP 1.57: Domain d1e6oh1: 1e6o H:1-120

Lineage for d1e6oh1 (1e6o H:1-120)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)

7. Species Fab 13B5 against HIV-1 capsid protein p24, (mouse), kappa L chain [48909] (2 PDB entries)

8. Domain d1e6oh1: 1e6o H:1-120 [20495]
   Other proteins in same PDB: d1e6oh2, d1e6ol2

Details for d1e6oh1

PDB Entry: 1e6o, 1.8 Å

PDB Description: crystal structure of fab13b5 against hiv-1 capsid protein p24

SCOP Domain Sequences for d1e6oh1:

Sequence; same for both SEQRES and ATOM records:

>d1e6oh1 b.1.1.1 (H:1-120) Immunoglobulin (variable domains of L and H chains) {Fab 13B5 against HIV-1 capsid protein p24, (mouse), kappa L chain}
evqlqqsgaelarpgasvkmsckasgytftsytmhwvkqrpgqglewigyinpssgysny
nqkfkdkatltadkssstaymqlssltsedsavyycsrpvvrlgynfdywgqgstltvss

Timeline for d1e6oh1:

• d1e6oh1 first appeared (with stable ids) in SCOP 1.55
  
• d1e6oh1 appears in SCOP 1.59
  
• d1e6oh1 appears in the current release, SCOPe 2.08