SCOPe 2.07: Domain d3orfb_: 3orf B:

Lineage for d3orfb_ (3orf B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (309 species)
   not a true protein

7. Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [226178] (1 PDB entry)

8. Domain d3orfb_: 3orf B: [214483]
   automated match to d1ooea_
   complexed with nad

Details for d3orfb_

PDB Entry: 3orf, 2.16 Å

PDB Description: Crystal Structure of Dihydropteridine Reductase from Dictyostelium discoideum

PDB Compounds: (B:) Dihydropteridine reductase

SCOPe Domain Sequences for d3orfb_:

Sequence; same for both SEQRES and ATOM records:

>d3orfb_ c.2.1.0 (B:) automated matches {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
sknilvlggsgalgaevvkffkskswntisidfrenpnadhsftikdsgeeeiksvieki
nsksikvdtfvcaaggwsggnassdeflksvkgmidmnlysafasahigakllnqgglfv
ltgasaalnrtsgmiaygatkaathhiikdlasengglpagstslgilpvtldtptnrky
msdanfddwtplsevaeklfewstnsdsrptngslvkfetkskvttwtnl

Timeline for d3orfb_:

• d3orfb_ first appeared in SCOPe 2.03
  
• d3orfb_ appears in SCOPe 2.06
  
• d3orfb_ appears in the current release, SCOPe 2.08