Lineage for d3orfb_ (3orf B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1346342Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1346343Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1349962Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1349963Protein automated matches [190069] (159 species)
    not a true protein
  7. 1351185Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [226178] (1 PDB entry)
  8. 1351187Domain d3orfb_: 3orf B: [214483]
    automated match to d1ooea_
    complexed with nad

Details for d3orfb_

PDB Entry: 3orf (more details), 2.16 Å

PDB Description: Crystal Structure of Dihydropteridine Reductase from Dictyostelium discoideum
PDB Compounds: (B:) Dihydropteridine reductase

SCOPe Domain Sequences for d3orfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3orfb_ c.2.1.0 (B:) automated matches {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
sknilvlggsgalgaevvkffkskswntisidfrenpnadhsftikdsgeeeiksvieki
nsksikvdtfvcaaggwsggnassdeflksvkgmidmnlysafasahigakllnqgglfv
ltgasaalnrtsgmiaygatkaathhiikdlasengglpagstslgilpvtldtptnrky
msdanfddwtplsevaeklfewstnsdsrptngslvkfetkskvttwtnl

SCOPe Domain Coordinates for d3orfb_:

Click to download the PDB-style file with coordinates for d3orfb_.
(The format of our PDB-style files is described here.)

Timeline for d3orfb_: