Lineage for d1etzl2 (1etz L:111-215)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 656556Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)
  7. 656637Species Mouse (Mus musculus) [TaxId:10090] [88571] (21 PDB entries)
  8. 656651Domain d1etzl2: 1etz L:111-215 [21442]
    Other proteins in same PDB: d1etza1, d1etzb1, d1etzb2, d1etzh1, d1etzh2, d1etzl1

Details for d1etzl2

PDB Entry: 1etz (more details), 2.6 Å

PDB Description: the three-dimensional structure of an anti-sweetener fab, nc10.14, shows the extent of structural diversity in antigen recognition by immunoglobulins
PDB Compounds: (L:) fab nc10.14 - light chain

SCOP Domain Sequences for d1etzl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1etzl2 b.1.1.2 (L:111-215) Immunoglobulin light chain lambda constant domain, CL-lambda {Mouse (Mus musculus) [TaxId: 10090]}
qpksspsvtlftpsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskq
snnkymassyltltarawerhssyscqvtheghtvekslsraecs

SCOP Domain Coordinates for d1etzl2:

Click to download the PDB-style file with coordinates for d1etzl2.
(The format of our PDB-style files is described here.)

Timeline for d1etzl2: