Class b: All beta proteins [48724] (165 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88571] (21 PDB entries) |
Domain d1etzl2: 1etz L:111-215 [21442] Other proteins in same PDB: d1etza1, d1etzb1, d1etzb2, d1etzh1, d1etzh2, d1etzl1 |
PDB Entry: 1etz (more details), 2.6 Å
SCOP Domain Sequences for d1etzl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1etzl2 b.1.1.2 (L:111-215) Immunoglobulin light chain lambda constant domain, CL-lambda {Mouse (Mus musculus) [TaxId: 10090]} qpksspsvtlftpsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskq snnkymassyltltarawerhssyscqvtheghtvekslsraecs
Timeline for d1etzl2: