SCOP 1.73: Domain d1etzh2: 1etz H:127-228

Lineage for d1etzh2 (1etz H:127-228)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries)

8. Domain d1etzh2: 1etz H:127-228 [21443]
   Other proteins in same PDB: d1etza1, d1etza2, d1etzb1, d1etzh1, d1etzl1, d1etzl2

Details for d1etzh2

PDB Entry: 1etz, 2.6 Å

PDB Description: the three-dimensional structure of an anti-sweetener fab, nc10.14, shows the extent of structural diversity in antigen recognition by immunoglobulins

PDB Compounds: (H:) fab nc10.14 - heavy chain

SCOP Domain Sequences for d1etzh2:

Sequence; same for both SEQRES and ATOM records:

>d1etzh2 b.1.1.2 (H:127-228) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqsg
lytmsssvtvpsstwpsqtvtcsvahpassttvdkklepsgp

Timeline for d1etzh2:

• d1etzh2 first appeared (with stable ids) in SCOP 1.55
  
• d1etzh2 appears in SCOP 1.71
  
• d1etzh2 appears in SCOP 1.75
  
• d1etzh2 appears in the current release, SCOPe 2.07