Lineage for d3obvc_ (3obv C:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1745105Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1745106Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 1745619Family a.118.1.23: Diap1 N-terninal region-like [140830] (2 proteins)
    contains two consequitive Pfam domains in one superhelical segment: Pfam PF06371 and Pfam PF06367
    this is a repeat family; one repeat unit is 2bap A:217-262 found in domain
  6. 1745620Protein Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) [140831] (1 species)
  7. 1745621Species Mouse (Mus musculus) [TaxId:10090] [140832] (4 PDB entries)
    Uniprot O08808 133-475! Uniprot O08808 135-435! Uniprot O08808 83-443
  8. 1745626Domain d3obvc_: 3obv C: [214296]
    automated match to d2bapa1
    complexed with suc

Details for d3obvc_

PDB Entry: 3obv (more details), 2.75 Å

PDB Description: autoinhibited formin mdia1 structure
PDB Compounds: (C:) Protein diaphanous homolog 1

SCOPe Domain Sequences for d3obvc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3obvc_ a.118.1.23 (C:) Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) {Mouse (Mus musculus) [TaxId: 10090]}
essrsammyiqelrsglrdmhllscleslrvslnnnpvswvqtfgaeglaslldilkrlh
dekeetsgnydsrnqheiirclkafmnnkfgiktmleteegilllvramdpavpnmmida
akllsalcilpqpedmnervleamteraemdeverfqplldglksgtsialkvgclqlin
alitpaeeldfrvhirselmrlglhqvlqelreienedmkvqlcvfdeqgdedffdlkgr
lddirmemddfgevfqiilntvkdskaephflsilqhlllvrndyearpqyyklieecvs
qivlhkngtdpdfkcrhlqidi

SCOPe Domain Coordinates for d3obvc_:

Click to download the PDB-style file with coordinates for d3obvc_.
(The format of our PDB-style files is described here.)

Timeline for d3obvc_: