Lineage for d1f4yl2 (1f4y L:111-210)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1105902Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1109002Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)
  7. 1109088Species Mouse (Mus musculus) [TaxId:10090] [88571] (21 PDB entries)
    Uniprot Q8N355 20-230 # 94% sequence identity; natural chimera: antibody light chain (Fab HYB3)
  8. 1109113Domain d1f4yl2: 1f4y L:111-210 [21418]
    Other proteins in same PDB: d1f4yh1, d1f4yh2, d1f4yl1
    part of anti-carbohydrate Fab S-20-4
    complexed with mgu

Details for d1f4yl2

PDB Entry: 1f4y (more details), 2.8 Å

PDB Description: crystal structure of an anti-carbohydrate antibody directed against vibrio cholerae o1 in complex with antigen
PDB Compounds: (L:) antibody s-20-4, fab fragment, light chain

SCOPe Domain Sequences for d1f4yl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f4yl2 b.1.1.2 (L:111-210) Immunoglobulin light chain lambda constant domain, CL-lambda {Mouse (Mus musculus) [TaxId: 10090]}
qpksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskq
snnkymassyltltarawerhssyscqvtheghtveksls

SCOPe Domain Coordinates for d1f4yl2:

Click to download the PDB-style file with coordinates for d1f4yl2.
(The format of our PDB-style files is described here.)

Timeline for d1f4yl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1f4yl1