![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins) |
![]() | Protein multi-copper oxidase CueO [69194] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [69195] (29 PDB entries) |
![]() | Domain d3nsda3: 3nsd A:336-516 [214041] automated match to d1n68a3 complexed with ag, cu, o |
PDB Entry: 3nsd (more details), 2 Å
SCOPe Domain Sequences for d3nsda3:
Sequence, based on SEQRES records: (download)
>d3nsda3 b.6.1.3 (A:336-516) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} slpalpslegltvrklqlsmdpmldmmgmqmlmekygdqamagmdhsqmmghmghgnmnh mnhggkfdfhhankingqafdmnkpmfaaakgqyerwvisgvgdmmlhpfhihgtqfril sengkppaahragwkdtvkvegnvsevlvkfnhdapkehaymahchllehedtgmmlgft v
>d3nsda3 b.6.1.3 (A:336-516) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} slpalpslegltvrklqlsmdpmldmmgmqmlmekygdqamagfhhankingqafdmnkp mfaaakgqyerwvisgvgdmmlhpfhihgtqfrilsengkppaahragwkdtvkvegnvs evlvkfnhdapkehaymahchllehedtgmmlgftv
Timeline for d3nsda3: