SCOPe 2.03: Domain d3nsda3: 3nsd A:336-516

Lineage for d3nsda3 (3nsd A:336-516)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)

6. Protein multi-copper oxidase CueO [69194] (1 species)

7. Species Escherichia coli [TaxId:562] [69195] (11 PDB entries)

8. Domain d3nsda3: 3nsd A:336-516 [214041]
   automated match to d1n68a3
   complexed with ag, cu, o

Details for d3nsda3

PDB Entry: 3nsd, 2 Å

PDB Description: silver bound to the multicopper oxidase cueo (untagged)

PDB Compounds: (A:) Blue copper oxidase cueO

SCOPe Domain Sequences for d3nsda3:

Sequence, based on SEQRES records:

>d3nsda3 b.6.1.3 (A:336-516) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]}
slpalpslegltvrklqlsmdpmldmmgmqmlmekygdqamagmdhsqmmghmghgnmnh
mnhggkfdfhhankingqafdmnkpmfaaakgqyerwvisgvgdmmlhpfhihgtqfril
sengkppaahragwkdtvkvegnvsevlvkfnhdapkehaymahchllehedtgmmlgft
v

Sequence, based on observed residues (ATOM records):

>d3nsda3 b.6.1.3 (A:336-516) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]}
slpalpslegltvrklqlsmdpmldmmgmqmlmekygdqamagfhhankingqafdmnkp
mfaaakgqyerwvisgvgdmmlhpfhihgtqfrilsengkppaahragwkdtvkvegnvs
evlvkfnhdapkehaymahchllehedtgmmlgftv

Timeline for d3nsda3:

• d3nsda3 is new in SCOPe 2.03-stable
  
• d3nsda3 appears in SCOPe 2.04
  
• d3nsda3 appears in the current release, SCOPe 2.08