![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
![]() | Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) ![]() |
![]() | Family d.104.1.0: automated matches [227172] (1 protein) not a true family |
![]() | Protein automated matches [226887] (9 species) not a true protein |
![]() | Species Thermococcus kodakarensis [TaxId:311400] [226766] (3 PDB entries) |
![]() | Domain d3nelb2: 3nel B:103-316,B:317-438 [213898] Other proteins in same PDB: d3nela1, d3nelb1 automated match to d1c0aa3 protein/RNA complex; complexed with asp |
PDB Entry: 3nel (more details), 1.95 Å
SCOPe Domain Sequences for d3nelb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nelb2 d.104.1.0 (B:103-316,B:317-438) automated matches {Thermococcus kodakarensis [TaxId: 311400]} tplpldptgkvkaeldtrldnrfmdlrrpevmaifkirssvfkavrdffhengfieihtp kiiatateggtelfpmkyfeedaflaqspqlykqimmasgldrvyeiapifraeehnttr hlneawsidsemafiedeeevmsflerlvahainyvrehnakeldilnfeleepklpfpr vsydkaleilgdlgkeipwgedidtegerllgkyXmmenenaplyflyqypseakpfyim kydnkpeicrafdleyrgveissggqrehrhdilveqikekglnpesfefylkafrygmp phggfglgaerlikqmldlpnirevilfprdrrrltp
Timeline for d3nelb2: