Lineage for d3ndpb1 (3ndp B:4-125,B:162-223)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2479613Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2479614Protein automated matches [190123] (156 species)
    not a true protein
  7. 2480081Species Human (Homo sapiens) [TaxId:9606] [186862] (202 PDB entries)
  8. 2480331Domain d3ndpb1: 3ndp B:4-125,B:162-223 [213887]
    Other proteins in same PDB: d3ndpa2, d3ndpa3, d3ndpb2, d3ndpb3
    automated match to d2ak3a1
    complexed with so4

Details for d3ndpb1

PDB Entry: 3ndp (more details), 2.3 Å

PDB Description: crystal structure of human ak4(l171p)
PDB Compounds: (B:) Adenylate kinase isoenzyme 4

SCOPe Domain Sequences for d3ndpb1:

Sequence, based on SEQRES records: (download)

>d3ndpb1 c.37.1.0 (B:4-125,B:162-223) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kllravilgppgsgkgtvcqriaqnfglqhlssghflrenikastevgemakqyieksll
vpdhvitrlmmselenrrgqhwlldgfprtlgqaealdkicevdlvislnipfetlkdrl
srXdkpeavaarprqykdvakpvielyksrgvlhqfsgtetnkiwpyvytlfsnkitpiq
skeay

Sequence, based on observed residues (ATOM records): (download)

>d3ndpb1 c.37.1.0 (B:4-125,B:162-223) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kllravilgppgsgkgtvcqriaqnfglqhlssghflrenikastevgemakqyieksll
vpdhvitrlmmselenrrgqhwlldgfprtlgqaealdkicevdlvislnirlsrXdakp
vielyksrgvlhqfsgtetnkiwpyvytlfsnkitpiqskeay

SCOPe Domain Coordinates for d3ndpb1:

Click to download the PDB-style file with coordinates for d3ndpb1.
(The format of our PDB-style files is described here.)

Timeline for d3ndpb1: