Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (58 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186862] (75 PDB entries) |
Domain d3ndpb1: 3ndp B:4-125,B:162-231 [213887] Other proteins in same PDB: d3ndpa2, d3ndpb2 automated match to d2ak3a1 complexed with so4 |
PDB Entry: 3ndp (more details), 2.3 Å
SCOPe Domain Sequences for d3ndpb1:
Sequence, based on SEQRES records: (download)
>d3ndpb1 c.37.1.0 (B:4-125,B:162-231) automated matches {Human (Homo sapiens) [TaxId: 9606]} kllravilgppgsgkgtvcqriaqnfglqhlssghflrenikastevgemakqyieksll vpdhvitrlmmselenrrgqhwlldgfprtlgqaealdkicevdlvislnipfetlkdrl srXdkpeavaarprqykdvakpvielyksrgvlhqfsgtetnkiwpyvytlfsnkitpiq skeaylehhhhhh
>d3ndpb1 c.37.1.0 (B:4-125,B:162-231) automated matches {Human (Homo sapiens) [TaxId: 9606]} kllravilgppgsgkgtvcqriaqnfglqhlssghflrenikastevgemakqyieksll vpdhvitrlmmselenrrgqhwlldgfprtlgqaealdkicevdlvislnirlsrXdakp vielyksrgvlhqfsgtetnkiwpyvytlfsnkitpiqskeaylehhhhhh
Timeline for d3ndpb1: