Lineage for d3nala3 (3nal A:344-360,A:600-750)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2526731Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2526732Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2527060Family c.108.1.7: Meta-cation ATPase, catalytic domain P [81656] (3 proteins)
    interrupted by a large insertion, domain N
  6. 2527061Protein Calcium ATPase, catalytic domain P [81655] (1 species)
  7. 2527062Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81654] (43 PDB entries)
    Uniprot P04191
  8. 2527093Domain d3nala3: 3nal A:344-360,A:600-750 [213856]
    Other proteins in same PDB: d3nala1, d3nala2, d3nala4
    automated match to d1wpga2
    complexed with dbk, k, mg

Details for d3nala3

PDB Entry: 3nal (more details), 2.65 Å

PDB Description: SR Ca(2+)-ATPase in the HnE2 state complexed with the Thapsigargin derivative DTB
PDB Compounds: (A:) SERCA1a

SCOPe Domain Sequences for d3nala3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nala3 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ctsvicsdktgtlttnqXldpprkevmgsiqlcrdagirvimitgdnkgtaiaicrrigi
fgeneevadraytgrefddlplaeqreacrraccfarvepshkskiveylqsydeitamt
gdgvndapalkkaeigiamgsgtavaktasemvladdnfstivaaveeg

SCOPe Domain Coordinates for d3nala3:

Click to download the PDB-style file with coordinates for d3nala3.
(The format of our PDB-style files is described here.)

Timeline for d3nala3: