SCOPe 2.07: Domain d3nala1: 3nal A:1-124,A:240-343,A:751-994

Lineage for d3nala1 (3nal A:1-124,A:240-343,A:751-994)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.33: Metal cation-transporting ATPase, transmembrane domain [81666] (1 superfamily)
   core: multihelical; consists of three transmembrane regions of 2, 2 and 6 helices, separated by cytoplasmic domains

4. Superfamily f.33.1: Metal cation-transporting ATPase, transmembrane domain [81665] (1 family)

5. Family f.33.1.1: Metal cation-transporting ATPase, transmembrane domain [81664] (2 proteins)

6. Protein Calcium ATPase, transmembrane domain M [81663] (1 species)
   the N-terminal 40 residues interact with /form a part of transduction domain A

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81662] (43 PDB entries)
   Uniprot P04191

8. Domain d3nala1: 3nal A:1-124,A:240-343,A:751-994 [213854]
   Other proteins in same PDB: d3nala2, d3nala3, d3nala4
   automated match to d1wpga4
   complexed with dbk, k, mg

Details for d3nala1

PDB Entry: 3nal, 2.65 Å

PDB Description: SR Ca(2+)-ATPase in the HnE2 state complexed with the Thapsigargin derivative DTB

PDB Compounds: (A:) SERCA1a

SCOPe Domain Sequences for d3nala1:

Sequence; same for both SEQRES and ATOM records:

>d3nala1 f.33.1.1 (A:1-124,A:240-343,A:751-994) Calcium ATPase, transmembrane domain M {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
meaahsksteeclayfgvsettgltpdqvkrhlekyghnelpaeegkslwelvieqfedl
lvrilllaacisfvlawfeegeetitafvepfvillilianaivgvwqernaenaiealk
eyepXaateqdktplqqkldefgeqlskvislicvavwlinighfndpvhggswirgaiy
yfkiavalavaaipeglpavittclalgtrrmakknaivrslpsvetlgXraiynnmkqf
irylissnvgevvcifltaalglpealipvqllwvnlvtdglpatalgfnppdldimdrp
prspkeplisgwlffrymaiggyvgaatvgaaawwfmyaedgpgvtyhqlthfmqctedh
phfegldceifeapepmtmalsvlvtiemcnalnslsenqslmrmppwvniwllgsicls
mslhflilyvdplpmifklkaldltqwlmvlkislpvigldeilkfiarnyleg

Timeline for d3nala1:

• d3nala1 first appeared in SCOPe 2.03
  
• d3nala1 appears in SCOPe 2.06
  
• d3nala1 appears in the current release, SCOPe 2.08