Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families) |
Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (2 proteins) automatically mapped to Pfam PF01220 |
Protein automated matches [190071] (5 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:1773] [189947] (15 PDB entries) |
Domain d3n8kq_: 3n8k Q: [213809] automated match to d3n8nd_ complexed with cl, d1x |
PDB Entry: 3n8k (more details), 2.25 Å
SCOPe Domain Sequences for d3n8kq_:
Sequence, based on SEQRES records: (download)
>d3n8kq_ c.23.13.1 (Q:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} livnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqlldwi hqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiat gvivglgiqgyllalrylaeh
>d3n8kq_ c.23.13.1 (Q:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} livnvingpnlgrlgrregtthdelvaliereaaelglkavvrqsdseaqlldwihqaad aaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiatgvivg lgiqgyllalrylaeh
Timeline for d3n8kq_: