SCOP 1.71: Domain d3fctc2: 3fct C:108-213

Lineage for d3fctc2 (3fct C:108-213)

Root: SCOP 1.71
Class b: All beta proteins [48724] (149 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
Species Human (Homo sapiens) [TaxId:9606] [88569] (100 PDB entries)
including humanized antibodies (chimeric proteins with human constant domains)

Domain d3fctc2: 3fct C:108-213 [21368]
Other proteins in same PDB: d3fcta1, d3fctb1, d3fctb2, d3fctc1, d3fctd1, d3fctd2
part of metal chelatase catalytic Fab 7G12; mature antibody
complexed with ca, cd, mg, mmp, na

Details for d3fctc2

PDB Entry: 3fct (more details), 2.4 Å

PDB Description: mature metal chelatase catalytic antibody with hapten

SCOP Domain Sequences for d3fctc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fctc2 b.1.1.2 (C:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens)}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrne

SCOP Domain Coordinates for d3fctc2:

Click to download the PDB-style file with coordinates for d3fctc2.
(The format of our PDB-style files is described here.)

Timeline for d3fctc2: