Lineage for d3fctd2 (3fct D:115-216)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 549023Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 549027Species Human (Homo sapiens) [TaxId:9606] [88575] (105 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
  8. 549082Domain d3fctd2: 3fct D:115-216 [21369]
    Other proteins in same PDB: d3fcta1, d3fcta2, d3fctb1, d3fctc1, d3fctc2, d3fctd1
    part of metal chelatase catalytic Fab 7G12; mature antibody
    complexed with ca, cd, mg, mmp, na

Details for d3fctd2

PDB Entry: 3fct (more details), 2.4 Å

PDB Description: mature metal chelatase catalytic antibody with hapten

SCOP Domain Sequences for d3fctd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fctd2 b.1.1.2 (D:115-216) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkivpks

SCOP Domain Coordinates for d3fctd2:

Click to download the PDB-style file with coordinates for d3fctd2.
(The format of our PDB-style files is described here.)

Timeline for d3fctd2: