Lineage for d3mzda1 (3mzd A:4-262)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012718Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 3012719Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 3012720Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. 3013542Protein Penicillin-binding protein 5, N-terminal domain [69875] (1 species)
  7. 3013543Species Escherichia coli [TaxId:562] [69876] (11 PDB entries)
  8. 3013553Domain d3mzda1: 3mzd A:4-262 [213657]
    Other proteins in same PDB: d3mzda2
    automated match to d1nzoa2
    complexed with cxv, gol

Details for d3mzda1

PDB Entry: 3mzd (more details), 1.9 Å

PDB Description: structure of penicillin-binding protein 5 from e. coli: cloxacillin acyl-enzyme complex
PDB Compounds: (A:) D-alanyl-D-alanine carboxypeptidase dacA

SCOPe Domain Sequences for d3mzda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mzda1 e.3.1.1 (A:4-262) Penicillin-binding protein 5, N-terminal domain {Escherichia coli [TaxId: 562]}
niktmipgvpqidaesyilidynsgkvlaeqnadvrrdpasltkmmtsyvigqamkagkf
ketdlvtigndawatgnpvfkgsslmflkpgmqvpvsqlirginlqsgndacvamadfaa
gsqdafvglmnsyvnalglknthfqtvhgldadgqyssardmaligqalirdvpneysiy
kekeftfngirqlnrngllwdnslnvdgiktghtdkagynlvasategqmrlisavmggr
tfkgreaeskklltwgfrf

SCOPe Domain Coordinates for d3mzda1:

Click to download the PDB-style file with coordinates for d3mzda1.
(The format of our PDB-style files is described here.)

Timeline for d3mzda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3mzda2