Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
Protein Penicillin-binding protein 5, N-terminal domain [69875] (1 species) |
Species Escherichia coli [TaxId:562] [69876] (11 PDB entries) |
Domain d3mzda1: 3mzd A:4-262 [213657] Other proteins in same PDB: d3mzda2 automated match to d1nzoa2 complexed with cxv, gol |
PDB Entry: 3mzd (more details), 1.9 Å
SCOPe Domain Sequences for d3mzda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mzda1 e.3.1.1 (A:4-262) Penicillin-binding protein 5, N-terminal domain {Escherichia coli [TaxId: 562]} niktmipgvpqidaesyilidynsgkvlaeqnadvrrdpasltkmmtsyvigqamkagkf ketdlvtigndawatgnpvfkgsslmflkpgmqvpvsqlirginlqsgndacvamadfaa gsqdafvglmnsyvnalglknthfqtvhgldadgqyssardmaligqalirdvpneysiy kekeftfngirqlnrngllwdnslnvdgiktghtdkagynlvasategqmrlisavmggr tfkgreaeskklltwgfrf
Timeline for d3mzda1: