Lineage for d3mwjb_ (3mwj B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1849617Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 1849618Protein automated matches [190123] (96 species)
    not a true protein
  7. 1850434Species Thermus thermophilus [TaxId:262724] [187453] (12 PDB entries)
  8. 1850437Domain d3mwjb_: 3mwj B: [213612]
    automated match to d1q0ua_
    complexed with so4; mutant

Details for d3mwjb_

PDB Entry: 3mwj (more details), 1.4 Å

PDB Description: Q28E mutant of HERA N-terminal RecA-like domain, apo form
PDB Compounds: (B:) heat resistant RNA dependent ATPase

SCOPe Domain Sequences for d3mwjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mwjb_ c.37.1.0 (B:) automated matches {Thermus thermophilus [TaxId: 262724]}
mefkdfplkpeilealhgrglttptpieaaalplalegkdligqartgtgktlafalpia
erlapsqergrkpralvltptrelalqvaseltavaphlkvvavyggtgygkqkeallrg
adavvatpgraldylrqgvldlsrvevavldeademlsmgfeeeveallsatppsrqtll
fsatlpswakrlaerymknpvlinvik

SCOPe Domain Coordinates for d3mwjb_:

Click to download the PDB-style file with coordinates for d3mwjb_.
(The format of our PDB-style files is described here.)

Timeline for d3mwjb_: