Lineage for d2f58l2 (2f58 L:108-212)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 103279Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 103650Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)
  7. 103709Species Anti-gp120 (HIV-1) Fab 58.2, (mouse), kappa L chain [49083] (3 PDB entries)
  8. 103715Domain d2f58l2: 2f58 L:108-212 [21346]
    Other proteins in same PDB: d2f58h1, d2f58l1

Details for d2f58l2

PDB Entry: 2f58 (more details), 2.8 Å

PDB Description: igg1 fab fragment (58.2) complex with 12-residue cyclic peptide (including residues 315-324 of hiv-1 gp120) (mn isolate)

SCOP Domain Sequences for d2f58l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f58l2 b.1.1.2 (L:108-212) Immunoglobulin (constant domains of L and H chains) {Anti-gp120 (HIV-1) Fab 58.2, (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnra

SCOP Domain Coordinates for d2f58l2:

Click to download the PDB-style file with coordinates for d2f58l2.
(The format of our PDB-style files is described here.)

Timeline for d2f58l2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2f58l1