Lineage for d2f58h1 (2f58 H:1-113)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 101995Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)
  7. 102078Species Anti-gp120 (HIV-1) Fab 58.2, (mouse), kappa L chain [48873] (3 PDB entries)
  8. 102083Domain d2f58h1: 2f58 H:1-113 [20355]
    Other proteins in same PDB: d2f58h2, d2f58l2

Details for d2f58h1

PDB Entry: 2f58 (more details), 2.8 Å

PDB Description: igg1 fab fragment (58.2) complex with 12-residue cyclic peptide (including residues 315-324 of hiv-1 gp120) (mn isolate)

SCOP Domain Sequences for d2f58h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f58h1 b.1.1.1 (H:1-113) Immunoglobulin (variable domains of L and H chains) {Anti-gp120 (HIV-1) Fab 58.2, (mouse), kappa L chain}
dvqlqqsgpdlvkpsqslsltctvtgysitsgyswhwirqfpgnklewmgyihysagtny
npslksrisitrdtsknqfflqlnsvttedtatyycareeampygnqayyyamdcwgqgt
tvtvss

SCOP Domain Coordinates for d2f58h1:

Click to download the PDB-style file with coordinates for d2f58h1.
(The format of our PDB-style files is described here.)

Timeline for d2f58h1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2f58h2