Lineage for d3mmbe3 (3mmb E:197-261)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1906288Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 1906422Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins)
    members of this "family" may be more closely related to other ferredoxins than to each other
  6. 1906480Protein DsrB insert domain [160277] (2 species)
  7. 1906481Species Archaeoglobus fulgidus [TaxId:2234] [160279] (8 PDB entries)
    Uniprot Q59110 197-261
  8. 1906497Domain d3mmbe3: 3mmb E:197-261 [213449]
    Other proteins in same PDB: d3mmba1, d3mmba2, d3mmba3, d3mmbb1, d3mmbb2, d3mmbd1, d3mmbd2, d3mmbd3, d3mmbe1, d3mmbe2
    automated match to d3mmcb1
    complexed with h2s, sf4, srm

Details for d3mmbe3

PDB Entry: 3mmb (more details), 2.3 Å

PDB Description: dissimilatory sulfite reductase in complex with the endproduct sulfide
PDB Compounds: (E:) sulfite reductase, dissimilatory-type subunit beta

SCOPe Domain Sequences for d3mmbe3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mmbe3 d.58.1.5 (E:197-261) DsrB insert domain {Archaeoglobus fulgidus [TaxId: 2234]}
rtppipndeairktceipstvaacptgalkpdmknktikvdvekcmycgncytmcpgmpl
fdpen

SCOPe Domain Coordinates for d3mmbe3:

Click to download the PDB-style file with coordinates for d3mmbe3.
(The format of our PDB-style files is described here.)

Timeline for d3mmbe3: