Lineage for d3mm8e3 (3mm8 E:197-261)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2192664Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 2192801Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins)
    members of this "family" may be more closely related to other ferredoxins than to each other
  6. 2192859Protein DsrB insert domain [160277] (2 species)
  7. 2192860Species Archaeoglobus fulgidus [TaxId:2234] [160279] (9 PDB entries)
    Uniprot Q59110 197-261
  8. 2192876Domain d3mm8e3: 3mm8 E:197-261 [213413]
    Other proteins in same PDB: d3mm8a1, d3mm8a2, d3mm8a3, d3mm8b1, d3mm8b2, d3mm8d1, d3mm8d2, d3mm8d3, d3mm8e1, d3mm8e2
    automated match to d3mmcb1
    complexed with no3, sf4, srm

Details for d3mm8e3

PDB Entry: 3mm8 (more details), 2.28 Å

PDB Description: dissimilatory sulfite reductase nitrate complex
PDB Compounds: (E:) sulfite reductase, dissimilatory-type subunit beta

SCOPe Domain Sequences for d3mm8e3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mm8e3 d.58.1.5 (E:197-261) DsrB insert domain {Archaeoglobus fulgidus [TaxId: 2234]}
rtppipndeairktceipstvaacptgalkpdmknktikvdvekcmycgncytmcpgmpl
fdpen

SCOPe Domain Coordinates for d3mm8e3:

Click to download the PDB-style file with coordinates for d3mm8e3.
(The format of our PDB-style files is described here.)

Timeline for d3mm8e3: